Biológia | Genetika » A genetika alapjai

Adatlap

Év, oldalszám:2007, 99 oldal
Nyelv:magyar
Letöltések száma:1005
Feltöltve:2008. március 11
Méret:18 MB
Intézmény:-

Csatolmány:-

Letöltés PDF-ben:Kérlek jelentkezz be!


Értékelések

11111 Michi 2010. május 27
  Szerintem ez egy kiválóan kidolgozott anyag, nekem legalábbis nagyon sokat segített.

Új értékelés

Tartalmi kivonat

Kromoszóma a genetikai informá információ ciót hordozó hordozó DNS egysé egység. „ A ví vírusok nukleinsava (ez lehet DNS vagy RNS) nem ké képes önálló lló reprodukció reprodukcióra. A má másolá solást a fertő fertőzött bakté baktérium vagy eukarió eukarióta sejt vé végzi. 1 „ „ „ „ „ T2,T4 fág: Terminá Terminális redundancia Cirkulá Cirkuláris permutá permutáció ció T3, T5,T7, fág: Terminá Terminális redundancia Teljes genom: genom: 12345 Terminá Terminális redundancia: 12345612 Cirkulá Cirkuláris permutá permutáció ció: 123456 456123 345612 Terminá Terminális redundancia és cirkulá cirkuláris permutá permutáció ció: 12345612 34561234 „ A prokarió prokarióták DNSDNS-e gyű gyűrű alakú alakú, s nem kapcsoló kapcsolódik hozzá hozzá [szerkezeti] fehé fehérje. 2 „ Az eukarió eukarióták DNSDNS-éhez fehé fehérjé rjék hisztonok is kapcsoló kapcsolódnak. 3 „ „

Gélelektroforé lelektroforézis Kromoszó Kromoszóma polimorfizmus „ „ Az emberek testi sejtjeiben 23 pá pár kromoszó kromoszóma van, minden pá párban az egyik apai, a má másik anyai. „ Kariotí Kariotípus Az ivarsejtek 23 pá párosí rosítatlan kromoszó kromoszómát tartalmaznak. Heterokromatin (sötét), eukromatin (világos)(gének) 4 „ „ „ „ „ G sá sávokvok- Giemsa Q sá á vok - quinacrin s R sá sávok - reverz „ „ „ „ „ Metacentrikus Submetacentrikus Akrocentrikus Telocentrikus Rövid karkar-p Hosszú Hosszú karkar-q 9q349q34-pl. 9 kromoszó kromoszóma hosszú hosszú karjá karjának 3.ré 3.régió gióján a 4.sá 4.sáv 5 A metafázisos kromoszóma kialakulása DNS +hiszton fehé fehérjé rjék +nem hiszton fehé fehérjé rjék 6 A H1 hiszton szerepe 146 védett nukleotid nukleoszómánként. 166 védett nukleotid nukleoszómánként, ha a H1 hiszton jelen van. H4 hiszton szekvenciája Nukleoszómás hisztonok

(102-135 aa): H2A H2B H3 H4 H1 (~220aa) A borsó és tehén H4 hisztonjának szekvenciája két aminósavba tér csak el. K = lizin (+) nem-hiszton fehérjék 7 Nukleoszóma mentes helyek érzékenyek a DNS bontó enzimekre A human genom ~ 2,3 cm ebben az állapotában. 8 A telomer szerkezete „ „ MiniMini-kromoszó kromoszómák Csirke:39makro-kromoszó kromoszóma Csirke:39-6 makro„ -33mini33mini-kromoszó kromoszóma rövid, gé génekben gazdag Stabilitá Stabilitás Telomer hossza „ B kromoszó kromoszómák Növények , gombá gombák, rovarok, Csö Csökkent életké letképessé pesség Eredet: A kromoszó kromoszómákbó kból (intraspecifikus) intraspecifikus) Idegen eredet (fajok kö közötti pá párosodá rosodás) 9 „ „ „ „ „ „ Nasonia vitripennis X N. giraulti rokon fajok, kü különbö nböző morfoló morfológiai és viselkedé viselkedésbeli mintá mintázat Új keletkezé keletkezésű B kromoszó kromoszóma kimutatá

kimutatása N. giraulti eredetű eredetű Centrikus fragmentek fennmaradtak, s tová továbbadó bbadódtak (Evolution, Evolution, 2001, 55:5. ,1069,1069-1073) 10 Kromoszóma vizsgálatok Pulzáló gélelektroforézis Kromoszó Kromoszómák szá száma Sávtechniká vtechnikák Aneuploidia N+1 N-1 1 Turner - XO Klinefelter szindróma 47 XXY férfias, nyúlánk, de nőies jegyek, sterilitás csökkent értelmi képesség Down-kór 21. triszómia 1313-triszó triszómia: Patau szindró szindróma hexadaktylia, hexadaktylia, farkastorok, nyú nyúlajak testi és szellemi visszamaradottsá visszamaradottság túlélés kb. 3 hó hónap 1818-triszó triszómia:Edwards szindró szindróma testi és szellemi visszamaradottsá visszamaradottság túlélés kb. 1é 1év 2 Kromoszó Kromoszóma mutá mutáció ció X kromoszó kromoszóma Az egyik X, korai embrioná embrionális fejlő fejlődés sorá során génikusan inaktivá inaktiválódik (gé (géndó ndózis

kompenzá kompenzáció ció) Véletlen, kloná klonális jelleg 3 XO (narancs) / Xo (fekete) fekete 4 Drosophila XX nősté stény Ember nő XY hí hím férfi XXY XO nősté stény hí hím férfi nő Drosophila: X - autoszó autoszóma ará arány 1:1 nősté stény Ember: Y kapcsol Kender, komló, sóska, fehér mécsvirág Y: női jelleg represszora portok képződés hím fertilitás XXXY-hím Euploidok Monoploid Minden kromoszó kromoszómából csak egy van Diploid Minden kromoszó kromoszómából kettő kettő van Polyploid Minden kromoszó kromoszómából tö több van Autopolyploid (tö (többszö bbszörös monoploid készlet) triploid (3n) (baná (banán, mag né nélkü lküli dinnye, ezü ezüst ká kárász) tetraploid (4n) (nagyobb mé méret, steril) Allopolyploid (ké (két vagy tö többfé bbféle kromoszó kromoszóma – készlet) (mustá (mustár, repce) (bú (búza,6X) 5 káposzta, karfiol, brokkoli, Kelkáposzta, karalábé

kelbimbó mustár repce 6 Sejtciklus Replikáció kettős szálú DNS-molekula szintézise egy egyszálú molekulából, az első szál mentén, a bázispárosodási szabályoknak megfelelően. Meselson -Stahl Replikáció • • • • • • • Szemikonzervatív Origó 1 vagy 2 irányú 5’3’ Rátája általában konstans Szemidiszkontinuus (okazaki fragment) Replikon (önálló replikációs egység) 1 Replikáció típusai Duplaszálú cirkuláris DNS 2 • • • • • • E. coli :47 x 106 nt Replikáció sebessége: kb. 1000 nt/sec 40 minutes. "proof-reading" function ↓ 1 hibás nt /109 beépített nt. • Humán kromoszóma: átlag 150X106 nt pár • 50nt pár/sec • Szabályzása: pozitív – negatív 3 Pozitív szabályzás ♥ORC (végig kötődik) ♥ „licensing factors” : CDC6, CDT1(ORC-hez kötődik) MCM replikáció elkezdődik: CDC6, CDT1 leválik Negatív szabályzás • Geminin nevű fehérje • Akadályozza

az MCM összeszerelését 4 5 Pontosság-ellenőrzés Termináció A primerek eltávolítása után visszamaradt hézagot ki kell tölteni • Eukarióta kromoszóma végei: GC gazdag, ismétlődő szekvencia Pl. Tetrahymena: TTGGGG AACCCC 6 • Tetrahymena telomeráz: • 159 nt RNS szakasz • CAACCCCAA szekvenciát tartalmaz Primer lehasítás a lineáris molekula végéről és a Telomeráz nem pótolja Tetrahymena telomeráinak kialakulása Hibridizáció a telomeráz templát RNS-e és a telomera 3’ végének G - gazdag szakasza között 7 MUTÁCIÓ • Mutagén anyagok kémiai, vagy más tényező (pl. sugárzás), amely a sejt DNS-ében mutációt okoz[hat]. • De Vries • mutáció - véletlenszerű változás a DNS vagy a kromoszóma szerkezetében. • Mutációs ráta Típusai: 2.Testi-ivari sejt (gén-onkogén) 1.Spontán-indukált 1 3. Fenotípus szerint: morfológiai letális feltételes (hőmérséklet) biokémiai 2 •

Auxotróf mutáció • trpE- trpD- trpC- trpB• ↓ ↓ ↓ ↓ • géntermék • →→→→→→→→ • • trpA ↓ rezisztencia ‫٭‬ nincs géntermék ↓ nincs triptofán 4.Pont-kromoszóma 5.Back mutáció 6.Szuppresszor mutáció A genetikai kód tulajdonképpen egy jelkulcs. Három bázisból álló csoport (kodon), mely egy adott aminosavat kódol. 3 • univerzális (általános érvényű) • bázishármasok • egy bázis egyidejűleg csak egy tripletthez tartozik pl. ATGTTT • degenerált (egyetlen aminosavat több bázishár-mas is kódolhat) • pl. leucin: CUU, AUA, UUA • lötyögés pl. szerin: UCU, UCC, UCA, UCG • vesszőmentes leolvasás pl. ATGCCCTTGAGC „ Missense” mutáció ATG GGA GCT CTA TTA ACC TAA Met gly ala leu leu thr stop ↓ TTT phe 4 „Silent” mutáció „Frameshift” mutáció Inszerció ATG GGA GCT CTA TTA ACC TAA Met gly ala leu leu thr stop ↓ TTG leu „Nonsense” mutáció ATG GGA GCT CTA TTA ACC

TAA Met gly ala leu leu thr stop ↓ TGA stop deléció G ↓ ATG GGA GCT CTA TTA ACC TAA Met gly ala leu leu thr stop ↓ GGG AGC TCT ATT AAC CTA ATT TGA gly ser ser ile asn leu ile stop • Báziscsere: tranzíció purin purin pirimidin pirimidin • purin pirimidin transzverzió pirimidin purin 5 • Forró pontok E. coli CCAGG ↓ 5-metil citozin→T 6 Replikációs hiba • CACACACACA GTGTGTGTGT ↓ CACACACACACA CACACACACA GTGTGTGTGT CACACACACA GTGTGTGTGT vad Hdh gén 10-35X FRAXA 6-52X mutáns 5’- CAG-3’ 36-121X ↓ Huntington szindróma 5’- CGG-3 60-1000 ↓ törékeny X 7 Repair-hibajavítás Fotorepair Replikáció gátlódik • E. coli 1947 Fotoliáz kapcsolódik a dimerhez Látható fény Eredeti állapot visszaállítása • Javítás a hibás DNS szakasz kivágásával • (excíziós repair) NER (nukleotid excízió) • BER (bázis excízió) C→U 1 • Javítás O6-metil guanozin alkil transzferázzal Nem-komplementer

bázispárok kijavítása Rekombinációs vagy replikáció utáni javítás 2 SOS repair Gátolt állapot • A DNS-ben felismerhetetlenné vált egy bázis→replikáció leáll, aktiválódik az SOS • lexA represszor + SOS regulon (20 gén) • umuC,umuD kapcsolódnak a DNS polimerázhoz→ felfüggesztik annak szigorúságát →véletlenszerűen beépül egy nukleotid → replikáció megy tovább, magas mutációs gyakoriság 3 Rekombináció z Rekombiná Rekombináció ció: A szü szülői gé gének és kromoszó kromoszómák újrarendező jrarendezőséből létrejö trejött új genetikai kombiná kombináció ciók. z Részben a gé génkicseré nkicserélődés, ré részben a kromoszó kromoszómák vé véletlenszerű letlenszerű eloszlá eloszlásának kö következmé vetkezménye Rekombináció replikáció során z Homoló Homológ z Helyspecifikus z NemNem-homoló homológ Gamétaképzés z Homoló Homológ rekombiná rekombináció ció 1

Rekombiná Rekombináció ció menete kettő kettős szá szálú törés 2 z Rekombiná Rekombináció ció egyszá egyszálú töréssel Kettős rekombináció E. coli Rekombináció iniciálása 3 Kapcsolt gé gének: Azonos kromoszó kromoszómapá mapáron egymá egymás közelé zelében elhelyezkedő elhelyezkedő gének, amelyek együ együttesen öröklő klődnek. zA génté ntérké rképezé pezés sorá során a gének egymá egymástó stól való való távolsá volságát, a genomban való való viszonylagos elhelyezkedé elhelyezkedésüket hatá határozzuk meg ané anélkü lkül, hogy való valóban megszekvená megszekvenálná lnánk a DNSDNS-t. é szen á ll a té é rké z Amint ké k t rkép, ké képesek vagyunk egy ismert gén vagy marker (ismert DNS szekvencia) alapjá alapján megmondani egy má másik gé gén helyé helyét a genomban. . genomban z Rekombiná Rekombináció ciós gyakorisá gyakoriság= rekombiná rekombinánsok szá

száma / összes egyed szá száma z 1% rekombiná rekombináció ció= 1 té térké rképegysé pegység (cM) cM) z Crossing overover-gének távolsá volságaga-T. Morgan z Helyspecifikus rekombináció zΛ fág- E. coli z Immunrendszer z S. cerevisiae párosodási típus cseréje 4 5 • Genetikai információ átvitele és rekombináció baktériumokban • Transzformáció • Konjugáció • Transzdukció 1 2 IS IS 3 Expresszió z Transzkripció (DNS→ DNS→RNS) z Posztranszkripciós Az információ hű megnyilvánultatása modifikációk (RNS-érés) z Transzláció z Poszttranszlációs modifikációk (fehérje-érés) Transzkripció DNS bázisszekvenciá zisszekvenciái RNS komplementer szekvenciá szekvenciáiba íródnak át. z Szelektív információelőhívás -értelmesrtelmes-értelmetlen szá szál -informá á ció ó s blokkok á tírása nform ci Egy adott sejtben adott idő időpillanatban nem minden gén íródik át.

Bizonyos gének a sejt v szervezet életé letének csak egy meghatá meghatározott szakaszá szakaszában aktí aktívak, vak, míg mások, sok, pl. az energiatermelé dnek. energiatermelésben szereplő szereplők, állandó llandóan működnek. RNS kó kópiaszá piaszám -RNS élettartam - 1 z Iniciá Iniciáció ció z Elongá Elongáció ció z Terminá Termináció ció z RNS polimerá polimeráz enzim vé végzi az átírást Prokarió ó ta Eukarió Prokari Eukarióta Sok alegysé alegység Működése: Iniciá Iniciáció ció,elongá ,elongáció ció,terminá ,termináció ció Templá Templátja a ss DNS Promó Promóter Kezdé Kezdés (pppG (pppG,, pppA) pppA) Foszfodié Foszfodiészter kötések, 5’ 5’-3’ Terminá Termináció ciós szigná szignált érzé rzékeli Aktivá Aktivátor vagy represszor proteinek „core enzim” z z z z ”core enzim” enzim” amely két α , egyegy-egy β és β ’ alegysé alegységbő gből áll (2 α β β’).

α : promó promóterhez való való kötődés β’ felelő felelős a DNS templá templáthoz való való kötődésért β felelő felelős a nukleotidkö nukleotidkötésért E. coli RNS polimerá polimeráz enzim két fő komponensbő komponensből áll. ll. z Az z ”core enzim” enzim” z szigmaszigma-faktor core enzim + szigmaszigma-faktor = holoenzim. holoenzim. szigma-faktor szigmaszigma-faktor (σ):az iniciá iniciáció cióhoz, hoz, közelebbrő zelebbről a promó promóter szekvencia felismeré felismeréséhez szü szüksé kséges. ges. 2 z Speciá Speciális körülmé lmények között (hősokk v. nitrogé nitrogén-éhezé hezés ) új szigmaszigma-faktorok megjelené megjelenése z →új z Prokarióta átírási egység: RNS polimerá polimeráz holoenzimek eddigiektő eddigiektől elté eltérő szekvenciá szekvenciájú promó promótereket ismernek fel. fel. 3 A Rho faktor a transzkriptumhoz kötődik A Rho faktor fellazítja az RNSDNS

kötéseket Eukarióták 4 5 6 Génexpresszió Prokarió Prokarióta Eukarió Eukarióta z 1 RNS polimerá polimeráz Transzkripció Transzkripció-transzlá transzláció ció egyidejű egyidejűleg 3 RNS polimerá polimeráz RNS érés, transzport, transzlá transzláció ció z DNSDNS-RNS z mRNS policisztronos z ExonExon-intron mRNS monocisztronos 7 rRNS és tRNS érése Poszttranszkripciós modifikáció RNS-érés • Transzkripciós egységekbe tömörülnek a gének • Nagy molekulatömegű elsődleges átírat szintetizálódik • Az egységekről készült másolatot fel kell darabolni t-RNS Endonukleázok Exonukleázok • mRNS-ek érése • Eukariótákban • 5’7-metil-guanozin-tri vagy polifoszfáton át • 3’poli-A-farok (átlag 200X) • splicing=összeillesztés Védelem mRNS- riboszóma illesztés 1 Az eukarióta gének mozaikosak poliA-farok: hossza különböző lehet mRNS-DNS hibridizáció Intron kihasítás

(splicing) Exon/GU-intron-AG-exon Kis nukleáris RNS-ek (snRNS-ek) Alternatív helyek U1 szekvenciájakomplementere a konszenzusszekvenci ának 2 Self-splicing • Ribozimek: RNS enzimek, melyek RNS molekulák hasítására alkalmasak Alternatív splicing 3 4 Szabályzás transzkripciós szinten Laktóz operon Laktóz operon struktúrája Laktóz jelenléte Glükóz és laktóz jelenléte 1 Triptofán (trp) operon Azon enzimek gé génjeit tartalmazza, amelyek a triptofá triptofán szinté szintézisé ziséhez szü szüksé kségesek (5 db gén). (felé (felépítő folyamatot katalizá katalizáló enzimek) (a szinté szintézis vé végtermé gtermékének jelenlé jelenlétében általá ltalában represszá represszálódnak, dnak, azaz magas triptofá triptofán koncentrá koncentráció ciónál, a trp operon struktú struktúrgé rgénjei nem íródnak át) Másik szabályzás: attenuáció Represszor jelenlé jelenlétében is jelentő jelentős a

trp operon átírása. Az operá operátor és az első első struktú struktúrgé rgén között van a: trp vezé vezér szekvencia attenuá attenuátor attenuá attenuátor A transzkripció transzkripció idő idő elő előtti megszakí megszakítása A magas trp koncentrá koncentráció ció ellené ellenére megindult transzkripció transzkripció 90%90%-os esé eséllyel befejező befejeződik az attenuá attenuátor régió gióban Az attenuá attenuátor régió giótartalmaz egy inverz repetití repetitív szekvenciá szekvenciát- hajtű hajtűszerkezet alakul kiki-a polimerá polimeráz leá leállll-a transzkripció transzkripció megszakad A polimeráz áthalad az attenuátor szekvencián 2 Az attenuátor leállítja a transzkripciót 3 Transzláció riboszóma m-RNS Különbsé nbségek az eukarió eukarióta és prokarió prokarióta mRNS felé felépítésében. riboszóma „ „ 20 000 riboszó riboszóma - E. coli (25% szá szárazanyag). 10 000 000

riboszó riboszóma -a gyorsan szaporodó szaporodó emberi sejtekben . 1 A 16S rRNS szerkezete „ „ t-RNS Aktiváló enzim helye Kötőhely m-RNS részé szére Kötőhely t-RNS részé szére Aminoacil t-RNS szintetáz Riboszómához való kötődés „ „ „ Iniciá Iniciáció ció iniciáció Elongá Elongáció ció Terminá Termináció ció 2 Kodon-antikodon A kódszótár A lötyögési szabály A transzláció kezdő szignálja 3 „ „ „ „ Homo sapiens similar to Transcription initiation factor TFIID subunit 11 (Transcription (Transcription initiation factor TFIID 28 kDa subunit) subunit) (TAF(II)28) (TAFII(TAFII-28) (TAFII28) (TFIID subunit p30p30-beta) (LOC391766), mRNA ATGGAGACCGGCAGGCAAACAGGCGTGTCTGCTGAG ATGCTCGCC CTCGCCATG ATGCCC CCC ATGGAGACCGGCAGGCAAACAGGCGTGTCTGCTGAGATG CGAGGTCTGAAGGGCAGCAAGAAGGATG GAATCCCTGAGGACCTAGATGGG CGAGGTCTGAAGGGCAGCAAGAAGGATGGAATCCCTGAGGACCTAGATGGG AACTTGGAAGAACCCAGGGATCAGGAAGGTGAGCTCAGGAGTGAGGATG TC

AACTTGGAAGAACCCAGGGATCAGGAAGGTGAGCTCAGGAGTGAGGATGTC ATGGACCTCACAGAAGGTGACAGTGAGGCCTCAGCCTCAGCTCCTCCTGCA ATGGACCTCACAGAAGGTGACAGTGAGGCCTCAGCCTCAGCTCCTCCTGCA GCCAAAAGACGGAAAACACATACGAAACGCAAGAAGGAGAGGAAGCCCACC GTGGATG CAGAGGAGGCTCAGAGGATGACAACCCTGCTGTCTGCCATGTCT GTGGATGCAGAGGAGGCTCAGAGGATGACAACCCTGCTGTCTGCCATGTCT GAGGAGCAGCTGTCCCGCTACGAAGTGTGTCGCCGGTCAGCTTTCCCAAGA GCACGCATTGCGGGTCTGATG CGGTCTATCACTGGCAGTTCGGTGTCTGAG GCACGCATTGCGGGTCTGATGCGGTCTATCACTGGCAGTTCGGTGTCTGAG AACGCGGCCATTGCCATGGCTGGAATAGCCAAGGTCTTTGTTGGAGAGGTG GTGGAAGAGGCCCTGGACATGTGTGAGATGTGGGGAGAGACGCCCCCGCTG CAGCCCAAGCATTTAAGGGAGGCTGTTCACAGGTTAAAGCCCAAGGGCCTC TTCCCCAACAGCAACTACAAAAGAGTCATGTTCTAG elongáció termináció 4 A transzlációs faktorok 5 Transzlációs frameshift +1 -1 tö több nukleotidnyi csú csúszá szás Spontá Spontán: ritka Gyakorisá Gyakorisága megnő megnőhet: ‫٭‬tRNS antikodon hurok strukturá strukturális változá ltozása „ „ „ „ „ „ ‫٭‬hiá hiány valamelyik

aminosavbó aminosavból ↓ lassulá lassulás, szü szünet Szabályzás transzlációs szinten ‫٭‬csú csúszá szásra hajlamosí hajlamosító helyek pl. AA-AAUAAU-UUAUUAU-UUAUUA-AACAAC- „ Pl. éhezé hezés, ví vírus fertő fertőzés, hősokk stb. hatá hatására a sejt csö csökkenti a protein szinté szintézist Protein érési folyamata 1 „ „ „ hossz Mitokondriumba: Mitokondriumba: Kloroplasztisz 1212-30 25 „ „ „ „ „ „ Belső Belső szigná szignál Nukleusz C terminá terminális szigná szignál Peroxiszó Peroxiszóma Diszulfid hidak „ Szigná Szignál szekvencia hasí hasítása „ Glikozilá Glikozilálás Mesterséges protein hibrid gének létrehozásával N terminá terminális szigná szignál „ „ Protein X Mitokonrium Protein Y citoszó citoszólban marad 77-9 Hibrid 3 2 3 Saccharomyces cerevisiae Animal Cell Illustration With Hyperlinked Labels Human Liver Cell Human Red Blood Cells Sejtciklus „ „

A sejtciklus az eukarió eukarióta sejtben két osztó osztódás kö között lejá lejátszó tszódó folyamat. Interfá Interfázisbó zisból, mitó mitózisbó zisból és a sejt osztó osztódásából áll. „ A G1 fázis az első első növekedé vekedési szakasz. „ Az S fá fázis a DNS repliká replikáció ció helye. „ „ A G2 fá fázis a má második növekedé vekedési szakasz, a sejt felké felkészí szítése az osztó osztódásra. Az M fá fázis vagy mitó citokinézis, zis, a mitózis és citokiné sejt ketté kettéválása ké két utó utódsejtre. 1 „ „ Ha a rendszer hibá hibát észlel: Utasí Utasítja a sejtet a programozott sejthalá sejthalál véghezvitelé ghezvitelére (pl. ha a p53 nevű nevű fehé fehérje DNS károsodá rosodást észlel). „ A sejtciklust a ciklin fehé fehérjé rjék és a ciklinciklin-dependens kiná kinázok együ együttesen szabá szabályozzá lyozzák. Kisebb mé mérté rtékű károsodá

rosodásná snál a repará reparáció ciót indí indítja be, emellett pedig leá leállí llítja a sejtciklust. „ Ciklinek: Ciklinek: – G1 ciklin (ciklin D) – S-phase ciklinek (ciklin E és A) – mitotikus ciklinek (ciklin B és A) Szintje fluktuá fluktuál „ CiklinCiklin-dependens kiná kinázok (Cdks) Cdks) – G1 Cdk (Cdk4) – S-phase Cdk (Cdk2) – M-phase Cdk (Cdk1) Szintje stabil 2 Mitó Mitózis: zis: azt a folyamatot jelenti, mely sorá egyenlő során a sejt két egyenlő utó utódsejtbe vá választja megkettő megkettőződött genomjá genomját. „ Általá ltalában ezt citokiné citokinézis követi, amely a citoplazmá citoplazmát és a sejtmembrá kettéosztja. sejtmembránt is ketté „ Az eredmé eredmény, ké két azonos utó utódsejt, közel azonos organellum elosztá elosztással. „ Interfázis Profázis „ „ „ „ Profá Profázisban a kromatin magasan szervezett kromoszó kromoszómákká kká kondenzá kondenzálódik. Az S

fá fázis DNS megkettő megkettőződése utá után a kromoszó kromoszómák testvé testvérkromatidokbó rkromatidokból állnak, melyek a centromeren keresztü keresztül kapcsoló kapcsolódnak össze. A sejtmagon kívül talá találjuk a ké két centroszó centroszómát, melyek a sejt mikrotubulusait koordiná koordináljá lják. Ezek a centroszó centroszómák a sejt ellenté ellentétes pólusaiba vá vándorolnak, mikö miközben formá formálódik az osztó osztódási orsó orsó. A maghá maghártya egyes terü területeken elveszti folytonossá folytonosságát. 3 „ Prometafázis „ Néhány esetben (gomba, alga) a zá zárt mitó mitózisban is ké képes penetrá penetrálni a mikrotubulus a sé sértetlen magmembrá magmembránt. „ „ A magmembrá magmembrán felbomlott, mikrotubulusok árasztottá rasztották el a sejtmag belsejé belsejét. Ezt nyitott mitó mitózisnak nevezzü nevezzük és csak a tö többsejtű bbsejtű szervezetekben jelenik

meg. A kromoszó kromoszómák kinetokó kinetokórjaihoz (azokhoz a helyekhez, melyekben a testvé testvérkromatidok összekapcsoló sszekapcsolódnak) kötődnek a hú húzófonalak (osztó (osztódási orsó orsók). A prometafá prometafázist gyakran a profá profázis részeké szeként emlí említik. Metafázis 4 A kromoszó kromoszómák, melyek a ké két pó pólus irá irányá nyába má már elkö elkötelezettek, de mé még egymá egymáshoz tapadó tapadó testvé testvérkromatirkromatidokbó dokból állnak, felsorakoznak az ún. egyenlí egyenlítői sí síkban. „ A sejt a sejtosztó sejtosztódás ezen állapotá llapotában vizsgá vizsgálható lható a legeredmé legeredményesebben. Klinikai kromoszó kromoszómavizsgá mavizsgálatokná latoknál is a metafá metafázisban blokkoljá blokkolják a sejtet, plé plédául kolhicinnel. kolhicinnel. „ Ez a legrö legrövidebb szakasz. Mikor a sí síkba rendező rendeződtek a kromoszó kromoszómák,

má már véget is ér. „ „ Két folyamat já játszó tszódik le: A testvé testvérkromatidokat összekö sszekötő fehé fehérjé rjék levá leválnak, ezá ezáltal a testvé testvérkromatidokbó rkromatidokból testvé testvérkromoszó rkromoszóma keletkezik, hiszen a húzófonalak megrö megrövidü vidülnek a megfelelő megfelelő pólusban elhelyezkedő elhelyezkedő centroszó centroszóma irá irányá nyában. A kinetokkó kinetokkórhoz nem kapcsoló kapcsolódó mikrotubulusok hosszabodnak, hosszabodnak, ezzel a sejt tökéletesen ellenté ellentétes pó pólusá lusába szorí szorítva a centroszó centroszómákat. kat. (Ezt a ké két fá fázist gyakran nevezik korai és késői anafá anafázisnak.) zisnak.) „ Az anafá anafázis jelenti a sejtciklus egyik ellenő ellenőrzé rzési pontjá pontját. Ha nem vá váltak szé szét megfelelő megfelelően a kromoszó kromoszómák, a sejtciklus gátlá tlás alá alá kerü kerül. „ A mitó mitózis

utó utóhatá hatásait tü tünteti el. A kinetokó kinetokórokhoz nem kapcsoló kapcsolódó mikrotubulusok tová tovább hosszabbodnak, ezzel is nö növelve a sejtek átmé tmérőjét. A pó pólusokhoz hú húzott kromoszó kromoszómák dekondenzá dekondenzálódnak, dnak, újbó jból összeszerelő sszeszerelődik a maghá maghártya körülöttü ttük. Anafázis Telofázis Citokinezis 5 „ „ A citokiné citokinézis, zis, azaz a sejt fizikai ketté kettéválása ekkor má már folyamatban van. Állati sejtekben az egyenlí egyenlítői síkban egy kontraktilis gyű gyűrű-rendszer jelenik meg, mely folyamatosan elszorí elszorítja a membrá membránt, ezzel mintegy ketté kettévágva a sejtet ké két utó utódsejtre. A mitó mitózis befejező befejeződött. Az eredmé eredmény: két teljesen azonos sejt. Nobel díj 2001 Paul Nurse 6 Hibák a mitózisban „ „ Veszé Veszélyesek, hiszen az utó utódsejt minden felmerü felmerülő defektust

hordozni fog. A nonnon-diszjunkció diszjunkcióban a kromoszó kromoszómák képtelenek egymá egymástó stól szé szétvá tválni, így az egyik sejtben tö ómia, többlet (trisz (triszó mia, hiszen há három kromoszó másikban hiá hiány kromoszóma van jelen), a má (monoszó monoszómia, mia, hiszen csak egy kromoszó kromoszóma talá található lható) fog keletkezni. Ezek a sejtek aneuploid sejtek, melyek hajlamosak rákos burjá burjánzá nzásra. „ „ A mitó mitózis traumatikus megpró megpróbáltatá ltatás a sejt szá számára. A sejt organellumainak szerkezete drá drámaian megvá megváltozik, a genetikai anyag kondenzá kondenzálódik, majd újbó jból felbomlik, ami kromoszó kromoszóma hibá hibákat, sé sérüléseket eredmé eredményezhet, ami pedig genetikai betegsé betegségekhez vezethet. Ilyen sé sérülés lehet az inverzió inverzió, , dupliá á ció transzloká á ció ó deléció ció. Ezen transzlok ci dupli ció, delé

sérülések nagy ré része halá halálhoz vezet. 7 A genomok típusai A genom struktúrája ƒ mikró mikróba : kromoszó kromoszómális tartalom + ƒ A bioló biológiá giában egy szervezet genomja a plazmidok ƒ gerincesek: gerincesek: kromoszó kromoszómális tartalom + mitokondrium ƒ teljes örökítő informá információ ciót jelenti, amely a DNSkódolva. DNS-ben van kó ƒ A kifejezé kifejezést elő előszö ször 19201920-ban Hans ƒ amit azonban nem tekintenek az emberi Winkler, Winkler, a hamburgi egyetem botanikus professzora haszná használta. genom részé szének. Ezt mitokondriá mitokondriális genomnak nevezik. A DNS mennyisé mennyisége nincs korrelá korreláció cióban a faj komplexitá komplexitásával A humá humán genom 46 kromoszó kromoszómából áll, melyeknek mindegyike tö több ezer gé gént és intergé intergénikus szakaszt tartalmaz. Gének száma egyes genomokban 2% Az intergé intergénikus szakaszok

tartalmazhatnak szabá szabályozó lyozó szekvenciá szekvenciákat és hulladé hulladék DNSDNS-t is. 30 000 Humán: „döglött” vírusok, ugráló gének Schizosaccharomyces pombe ~15 Mb és ~ 6700 gé gén 1 Kromoszóma és gén ƒ Eukarió Eukarióta genom általá ltalános jellemző jellemzői Gén sű sűrűség Élesztő lesztő: 50kb50kb- os fragmenten kb.20 gé gén talá található lható Humá Humán: 50kb50kb- os fragmenten kb.6 gé gén talá található lható ƒ Gé n Gének ƒ Homo sapiens ƒ similar to Transcription initiation factor TFIID subunit 11 (Transcription (Transcription initiation factor TFIID 28 kDa subunit) subunit) ƒ (TAF(II)28) (TAFII(TAFII-28) (TAFII28) (TFIID subunit p30p30beta) (LOC391766), mRNA ƒ ƒ ƒ ƒ ƒ ƒ ƒ ƒ ƒ ƒ ATGGAGACCGGCAGGCAAACAGGCGTGTCTGCTGAG ATGCTCGCC CTCGCCATG ATGCCCCGAGGTCTGAAGGGCAGCA CCCCGAGGTCTGAAGGGCAGCA ATGGAGACCGGCAGGCAAACAGGCGTGTCTGCTGAGATG AGAAGGATG

GAATCCCTGAGGACCTAGATGGGAACTTGGAAGAACCCAGGGATCAGGAAGGTGAGCTCAG AGAAGGATGGAATCCCTGAGGACCTAGATGGGAACTTGGAAGAACCCAGGGATCAGGAAGGTGAGCTCAG GAGTGAGGATG TCATG ATGGACCTCACAGAAGGTGACAGTGAGGCCTCAGCCTCAGCTCCTCCTGCAGCCAAA GACCTCACAGAAGGTGACAGTGAGGCCTCAGCCTCAGCTCCTCCTGCAGCCAAA GAGTGAGGATGTC AGACGGAAAACACATACGAAACGCAAGAAGGAGAGGAAGCCCACCGTGGATG CAGAGGAGGCTCAGAGGA AGACGGAAAACACATACGAAACGCAAGAAGGAGAGGAAGCCCACCGTGGATGCAGAGGAGGCTCAGAGGA TGACAACCCTGCTGTCTGCCATGTCTGAGGAGCAGCTGTCCCGCTACGAAGTGTGTCGCCGGTCAGCTTT TGACAACCCTGCTGTCTGCCATGTCTGAGGAGCAGCTGTCCCGCTACGAAGTGTGTCGCCGGTCAGCTTT CCCAAGAGCACGCATTGCGGGTCTGATG CGGTCTATCACTGGCAGTTCGGTGTCTGAGAACGCGGCCATT CCCAAGAGCACGCATTGCGGGTCTGATGCGGTCTATCACTGGCAGTTCGGTGTCTGAGAACGCGGCCATT GCCATGGCTGGAATAGCCAAGGTCTTTGTTGGAGAGGTGGTGGAAGAGGCCCTGGACATGTGTGAGATGT GCCATGGCTGGAATAGCCAAGGTCTTTGTTGGAGAGGTGGTGGAAGAGGCCCTGGACATGTGTGAGATGT GGGGAGAGACGCCCCCGCTGCAGCCCAAGCATTTAAGGGAGGCTGTTCACAGGTTAAAGCCCAAGGGCCT GGGGAGAGACGCCCCCGCTGCAGCCCAAGCATTTAAGGGAGGCTGTTCACAGGTTAAAGCCCAAGGGCCT

CTTCCCCAACAGCAACTACAAAAGAGTCATGTTCTAG Intron: Intron: Élesztő lesztő: nem Humá Humán: mind 2 ƒ Gének –példá ldányszá nyszám ƒ egy ƒ több Többszö bbszörös gé gének, dó dózis ismé ismétlő tlődés Mindké indkét kó kópia megő megőrzi eredeti funkció funkcióját, és ezzel a szervezet nagyobb mennyisé mennyiségű RNSRNS-t vagy fehé fehérjé rjét ké képes termelni. Dózis ismé ismétlő tlődésnek (dose repetition) nevezik. pl. hiszton hiszton gé gének, nek, tRNS, tRNS, rRNS gének. nek. A humá humán sejtek haploid genomja: genomja: rRNS gé gének szá száma kb. 300, tRNS gé génbő nből kb. 1300 kó kópia van jelen. A karmosbé karmosbéka (Xenopus laevis) genomja tö több mint ké kétszer nagyobb a humá humán genomná genomnál, rRNSrRNS-ből kb. 500, tRNStRNS-ből tö több mint 7 ezer másolat mutatható mutatható ki. ƒ Másolat működőképes marad, de mutá mutáció ciók kö következté vetkeztében valamilyen

mérté rtékben megvá megváltozik. á t dehidrogená ƒ pl. laktá lakt dehidrogenáz, aldolá aldoláz, kreatin kiná kináz), amelynek gé génjei tö több változatban vannak jelen a genomban. genomban. ƒ Az egyes enzimvá enzimváltozatok ugyanazt a reakció reakciót katalizá katalizáljá lják, de bioké biokémiai tulajdonsá tulajdonságaikban, szö szövet specifitá specifitásukban lehet elté eltérés. ƒ Géncsalá ncsaládok Az azonos eredetű eredetű, szekvenciá szekvenciájukban nagyon hasonló hasonló gének összessé sszessége . A gé géncsalá ncsalád tagjai tö többnyire egymá egymás közelsé zelségében helyezkednek el a kromoszó kromoszómán. α-globulinok β -globulinok 3 Az α- és a β-globulinok homoló homológ fehé fehérjé rjéinek aminosav szekvenciá szekvenciája közötti kü különbsé nbség meghaladja az 50%50%ot, ot, így e ké két csalá család (a mioglobinokkal) együ együtt, egy szupercsalá szupercsaládot

alkot. 1. Gé Gének, génkö nközeli szekvenciá szekvenciák Kódoló doló régió giók ƒ A populá populáció ciógenetikai vizsgá vizsgálatokban különös jelentő jelentősége van azoknak a géncsalá á ncsal doknak, doknak, amelyek tagjai azonos funkció funkciójú enzimet, vagy enzim domé domént kódolnak. ƒ Az enzimvá enzimváltozatok ugyanis egyszerű egyszerű eszkö eszközökkel, gé gél-elektroforé elektroforézissel kimutatható kimutathatók, és így egy populá populáció cióból sok egyed alapjá alapján lehet mé mérni a genetikai vá változatossá ltozatosságot. 2020-30% Nem kó kódoló doló Intron Gén elő előtti Gén utá utáni szekvenciá szekvenciák 2. Pszeudogé Pszeudogének A pszeudogé pszeudogének olyan gé génmá nmásolatok, amelyek kü különbö nböző mutá mutáció ciók kö következté vetkeztében minden funkció funkciót elvesztettek. ƒ Csak lá látszó tszólag kó kódol egy gé géntermé nterméket. ƒ

A pszeudogé pszeudogének keletkezé keletkezése: ƒ Egy gén inaktivá inaktiválódhat, dhat, ha a rá rá ható ható szelekció szelekciós nyomá nyomás kiszű kiszűri a tö többi kö közül. Pé Példá ldául, egy élőlényt körülvevő lvevő környezet úgy is megvá megváltozhat, hogy az adott gé gén termé termékére má már nincs szü szüksé kség, vagy aká akár károssá rossá is vá válhat. ƒ Egy gé gén dupliká duplikáció ciója egy genomban két ugyanolyan gént eredmé eredményezhet. Így egy inaktivá inaktiváló mutá mutáció ció az egyik gé génben nem okoz szelekció szelekciós nyomá nyomást vele szemben. ƒ Egy gé gén mRNS transzkriptumá transzkriptumának darabjai spontá spontán visszaí visszaíródhatnak reverz transzkripció transzkripcióval a kromoszó kromoszómális DNSDNS-be. 4 3. Génfragmentek Génen kivü kivüli szekvenciá szekvenciák 7080% 70 Repetití Repetitív szekvenciá szekvenciák Kukorica: sok

1.szé 1.szétszó tszórtan elhelyezkedő elhelyezkedő: SINEs (Alu csalá család) hossz kb. 250 bp, bp, 700 000 ƒ 2.Cluster2Cluster-ben elhelyezkedő elhelyezkedők ƒ Klasszikus szatellit DNS ƒ Miniszatellitek (telomer) telomer) ƒ Mikroszatellitek (5’ (5’-CA CA CA CA CACA-3’) (5’ (5’-AAAAAAAAAAAAAAAAAAAAAAAAAA-3’) LINEs( LINEs( nem virá virális retroelemek) retroelemek) 60 000X 5 ƒ „Junk DNA” DNA”- felesleges? Kicsi, fehé fehérjé rjét nem kó kódoló doló RNSRNS-ek génjei talá található lhatók.→ k.→mikro RNSRNSek→ ek→speciá speciális fehé fehérje komplexeket ismernek fel. →(RNS+ fehé fehérje egysé egység ) tö több funkció funkciójú Pl. kromoszó elnémulnak kromoszómákhoz kötödik→ dik→szakaszok elné mRNS 3’ –végi át nem íródó szekvenciá szekvenciáihoz kötődnek→ dnek→gátló tlódik az mRNS működése ƒ A humá humán genetikus variá variáció ciókró król szó szóló kutatá

kutatások az egyszerű egyszerű nukleotid polimorfizmusra (SNP) fókuszá kuszáltak, melyek egyszerű egyszerű báziskicseré ziskicserélődések a kromoszó kromoszómákon. ƒ A legtö legtöbb vizsgá vizsgálat szerint az SNPSNP-k szá száma 1:100 és 1:1000 bázispá zispár között van az eukromatikus régió giókban, habá habár nem mutatnak homogé homogén eloszlá eloszlást. →mRNS feldarabolá feldarabolása ↓↓↓ Gazda mRNSaktivitása , stabilitá stabilitása mRNS-ek aktivitá Parazita szekvenciá szekvenciák aktivitá aktivitása , stabilitá stabilitása ƒ Így nem mó módosul a szá számos genetikus által vallott ƒ DNS ujjlenyomat és az apasá apasági tesztek tesztek ƒ Az emlő emlős genomok komperatí komperatív genomikai megá megállapí llapítás, miszerint minden ember 99%99%-ban genetikailag megegyezik. tanulmá tanulmányozá nyozása sorá során kapott eredmé eredmények alapjá alapján úgy becsü becsülik, hogy genomunk

5%5%a konzervá konzerválódott az evolú evolúció ció sorá során azon fajok szé szétvá tválása óta. ƒ A csimpá csimpánz genom kb. 95%95%-ban egyezik a humá humán genommal. genommal. ƒ Átlagban, egy tipikus emberi fehé fehérjé rjét kó kódoló doló gén 2 aminó aminósavban különbö nbözik a csimpá csimpánz megfelelő megfelelőjétől. ƒ Csak az emberi gé gének egyharmadá egyharmadának van ugyanolyan fehé fehérje produktuma, mint a csimpá csimpánzban lé lévő megfelelő megfelelőjének. ƒ A legfő legfőbb kü különbsé nbség a ké két faj között a 2-es kromoszó kromoszóma, ma, mely a csimpá csimpánz 1212-es és 1313as kromoszó kromoszómák fú fúzió ziójának eredmé eredménye . 6 Mozgékony elemek a genomban Konzervatív transzpozíció Transzpozíció típusai • 1.Transzpozíció (DNS) • Konzervatív ( az elem kilép az eredeti helyéről és új helyre épül be) (az elem száma nem változik csak a helye)

• Replikatív • ( az elemről másolat készül és az ugrik az új helyre) • (az elem száma is változik) Mozgékony elem Célszekvencia ? Cél. Mozgékony elem Cél. 1 Replikatív transzpozíció Mozgékony elem Célszekvencia replikáció DNS Cél Mozgékony elem DNS Cél • 2.Retrotranszpozíció ( RNS szintézis) • Előbb átíródik RNS-be • Visszaíródik cDNS-be • Beépül az új helyre Retrotranszpozíció Mozgékony elem Célszekvencia transzkripció RNS Reverz transzkripció cDNS Mozgékony elem Cél cDNS Cél 2 A mozgékony genetikai elemek típusai Baktériumok: inszerciós szekvenciák transzpozonok Élesztők: Ty elem Drosophila: Copia elemek P elemek FB elemek Ízeltlábúak Férgek Emlősök Bakteriális transzpozonok (1960-as évek) • Inszerciós szekvenciák Csak az áthelyeződéshez szükséges elemeket taratalmazza • Transzpozonok Transzpozáz Amp. Rez Transzpozáz • Retroelemek 3 Prokarióta

inszerciós elemek • IS1 • IS2 5-8 példány 768bp hosszú 5 példány a kromoszómán 1327 1 példány az F plazmidban • IS4 • IS5 1-2 példány ismeretlen 1400 1250 Transzpozonok eukariótákban Rövid azonos állású ismétlődés 5-8 kb hossz • Drosophila: • copia-szerű elemek • FB elemek • P-elemek Fordított irányú ismétlődés Rövid fordított állású ismétlődés 4 • Mozgékony genetikai elemek plazmidokon • 1950 Japán Shigella • Több antibiotikummal szembeni rezisztencia • Átadódott más törzsekbe, rokon fajokba 5 Restrikciós enzimek Gazdaspecifitás 1960 W. Arber Fág ↓ A bakté baktérium tö törzs ↓ Fág Fág ↓ A bakté baktérium ↓ ↓ Fág ≥≥≥ ↓ B bakté baktérium ↓ ↓ Fá g fertő fertőzés mé mérté rtéke Restrikció Restrikciós enzimek alkalmazá alkalmazása: DNS restrikció restrikciós té térké rképe Populá Populáció ció-polimorfizmus DNS átrendező trendeződés,

mutá mutáció ció Mutá Mutánsok lé létrehozá trehozása Betegsé Betegségek diagnosztizá diagnosztizálása 1 Mutáció kimutatása restrikciós enzimmel •DNS restrikciós térképe Alkalmazá Alkalmazás: genetikai betegsé betegségek méhen belü belüli diagnó diagnózis: Sarló Sarlósejtes vé vérszegé rszegénysé nység GAG -GTG Glutaminsav-valin Glutaminsav-Mintavé Mintavétel, DNS izolá izolálás, emé emészté sztés restrikció restrikciós enzimmel Ligálás 2 Marker gén (baktérium) Vektor Replikáció Klónozó hely Marker gén (élesztő) Agaróz gél elektroforézis Alap: tölté ltéssel rendelkező rendelkező részecské szecskék elektromos erő erőtérben elmozdulnak Agaró Agaróz: Tengeri moszat D-galaktó galaktóz-L galaktó galaktóz polimerje DNS mozgását befolyásoló tényezők DNS mé mérete, konformá konformáció ciója Agaró Agaróz koncentrá koncentráció ció Puffer Feszü Feszültsé ltség Hőmérsé

rséklet EtidiumEtidium-bromid jelenlé jelenléte 15%15%-al csö csökkenti a mozgé mozgékonysá konyságot 3 Első Első génsebé nsebészeti kí kísérletek vírus baktérium Alkalmazás 4 Klónozás Génmegszakítás MCS SphI pUC-DIS vektor MCS SacI ura4+ start NotI adapter stop az ade gén az ade gént tartalmazó fragment deléció Integratív transzformálás 5 A géntermék túltermeltetése A géntermék helyének beazonosítása A magban van a mutáns pX fehérje. A citoplazmában van a pX fehérje. 6 Szekvencia meghatározása MaxamMaxam-Gilbert (ké (kémiai anyagokkal roncsolja a specifikus nukleotidokat) nukleotidokat) Sanger (szinté (szintézis) Left: A DNA sequencer at California State University, San Bernardino. Right: Door of sequencer is open to show a gel plate inside. 1980 Nobel Prize for Chemistry e peaks and valleys of a portion of a sequenced gene that correspond to the color-coded b bases, there are 434 = 2.951479 X

1020 or about 295 quintillion different possible sequence or home matching the murder victims DNA was 25 quadrillion to one. Walter Gilbert (USA, *21.31932) USA, Biological Laboratories, Cambridge, MA, Frederick Sanger (Great Britain, 13.81918) USA, Great Britain, Britain, MRC Laboratory of Molecular Biology, Biology, Cambridge, "for their contributions concerning the determination of base sequences in nucleic acids" acids". 1 2 Automata szekvenálók Szekvenálás eredménye a szekvená szekvenálási módszer egyegy-egy kísérlettel átlagosan mintegy 500 nukleotid hosszú hosszúságú DNSDNS-szakasz sorrendjé sorrendjét képes meghatá meghatározni >embl|X13976|SPURA4 Schizosaccharomyces pombe ura4 gene for orotidineorotidine-55-phosphate (OMP) decarboxylase .aagcttagctacaaatcccactggctatatgtatgcatttgtgttaaaaaagtttgtatagatt atttaatctactca .aagcttagctacaaatcccactggctatatgtatgcatttgtgttaaaaaagtttgtatagattatttaatctactca

gcattctttctctaaataggaatttgttacttaatggagaaaaaaatgtttcgatttacctagtgtatttgtttgtatactca gcattctttctctaaataggaatttgttacttaatggagaaaaaaatgtttcgatttacctagtgtatttgtttgtatactca cgtttaatttcaaacatccattctatcttgtgtaatttttggcatggtgaaaaagataatcagccttataatctttacaaa cgtttaatttcaaacatccattctatcttgtgtaatttttggcatggtgaaaaagataatcagccttataatctttacaaa agtaagaaattctgtaaataagccttaatgcccttgctttaaattaaaatggttctttttcatgataatgtttgcactttgt agtaagaaattctgtaaataagccttaatgcccttgctttaaattaaaatggttctttttcatgataatgtttgcactttgt gaatatattttagatagttctgtgaggtataattaagatgttttagagacttatacaattttgtctttataaattcttaattga gaatatattttagatagttctgtgaggtataattaagatgttttagagacttatacaattttgtctttataaattcttaattga ttttaccatcccagtttaactatgcttcgtcggcatctctgcacatgtcgtgttttcttaccgtattgtcctaccaagaacc ttttaccatcccagtttaactatgcttcgtcggcatctctgcacatgtcgtgttttcttaccgtattgtcctaccaagaacc tcttttttgcttggatcgaaattaaaggtttaaaagcaaagttatg gatgctagagtatttcaaagctattcagcta tcttttttgcttggatcgaaattaaaggtttaaaagcaaagttatggatgctagagtatttcaaagctattcagcta

gagctgaggggatgaaaaatcccattgccaaggaattgttggctttgatggaagaaaagcaaagcaa gagctgaggggatgaaaaatcccattgccaaggaattgttggctttgatggaagaaaagcaaagcaa cttgtcagtcgcggtcgatttgacgaagaaatccgaaatcttagaattggtagataaaattggaccctatg cttgtcagtcgcggtcgatttgacgaagaaatccgaaatcttagaattggtagataaaattggaccctatg tctgtgttatcaagacacatattgacgttgtcgaggatttcgaccaggatatggtagaaaaactggtggc tctgtgttatcaagacacatattgacgttgtcgaggatttcgaccaggatatggtagaaaaactggtggc cttaggtaaaaagcatcgttttcttatctttgaggatcgcaaattcgcagacattggaaataccgtcaagct cttaggtaaaaagcatcgttttcttatctttgaggatcgcaaattcgcagacattggaaataccgtcaagct acaatatgcatctggtgtgtacaaaattgcttcttgggctcatatcacaaattgccatacagtgccaggcg acaatatgcatctggtgtgtacaaaattgcttcttgggctcatatcacaaattgccatacagtgccaggcg agggtattatacaaggcctcaaagaagttggtttacctttgggacgtggtctcttgcttttggctgaaatgt agggtattatacaaggcctcaaagaagttggtttacctttgggacgtggtctcttgcttttggctgaaatgt cttccaaaggctctttggctactggttcctacacagagaaaaccttagaatggtttgagaagcataccga cttccaaaggctctttggctactggttcctacacagagaaaaccttagaatggtttgagaagcataccga

tttttgctttggctttatagctggtcgtcgatttcctaaccttcaaagcgactacataactatgtcccctggtat tttttgctttggctttatagctggtcgtcgatttcctaaccttcaaagcgactacataactatgtcccctggtat cggcttggatgttaaaggagacgggctgggacagcaatatcgtactcctgaagaagtgattgtaaact cggcttggatgttaaaggagacgggctgggacagcaatatcgtactcctgaagaagtgattgtaaact gcggtagcgatatcatcattgttggtcgtggagtctatggagctggtcgtaatcctgttgtcgaagccaa gcggtagcgatatcatcattgttggtcgtggagtctatggagctggtcgtaatcctgttgtcgaagccaa gagatatagagaagctggttggaaggcatatcagcaaagactttctcagcattaaaaaaagactaatgta gagatatagagaagctggttggaaggcatatcagcaaagactttctcagcattaaaaaaagactaatgta aaatttttttggttggttattgaaaaagtcgatgccttgtttgcgtttgttttcctaggcgttttatgtcagaaggcatttaga aaatttttttggttggttattgaaaaagtcgatgccttgtttgcgtttgttttcctaggcgttttatgtcagaaggcatttaga attagtatacaagtactctttggtaaaattttatgtagcgactaaaatattaactattatagataaacaccttgggaat attagtatacaagtactctttggtaaaattttatgtagcgactaaaatattaactattatagataaacaccttgggaat aaaaagtaatttgctatagtaatttattaaacatgctcctacaacattaccacaatcttttctcttggattgacattgaat

aaaaagtaatttgctatagtaatttattaaacatgctcctacaacattaccacaatcttttctcttggattgacattgaat aagaaaagagtgaatttttttagacttgtaatgataactatgtacaaagccaatgaaagatgtatgtagatgaatgt aagaaaagagtgaatttttttagacttgtaatgataactatgtacaaagccaatgaaagatgtatgtagatgaatgt aaaataccatgtagacaaacaagataaaacttggttataaacattggtgttggaacagaataaattagatgtcaa aaaataccatgtagacaaacaagataaaacttggttataaacattggtgttggaacagaataaattagatgtcaa aaagtttcgtcaatatcacaagctt A bioló biológiá giában a reading frame, frame, vagy olvasá olvasási keret a DNS vagy RNS egy folyamatos és nemnem-átfedő tfedő készlete a három nukleotidbó lló kodonnak. kodonnak. nukleotidból álló Három lehetsé lehetséges olvasá olvasási keret lé létezik, melyek egyenké egyenként a há három nukleotidró nukleotidról indulnak ki. Azt az olvasá olvasási keretet, mely tartalmaz egy start és egy stop kodont, kodont, open reading frameframe-nek nevezzü nevezzük (ORF). (ORF). 3 >gi|3982923|gb|AF093755.1|AF093755 Schizosaccharomyces pombe

sep15 gene, gene, No putative conserved domains have been detected complete sequence Length=1513 Score = 2206 bits (1113), Expect = 0.0 Identities = 1140/1140 (100%), Gaps = 0/1140 (0%) Strand=Plus/Plus Query 1 ACACATATGAATTGTAATTTATTCCTATTGTAACAAGTTTTAGGATAAAGAAAAAGCTCA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct330 ACACATATGAATTGTAATTTATTCCTATTGTAACAAGTTTTAGGATAAAGAAAAAGCTCA ACACATATGAATTGTAATTTATTCCTATTGTAACAAGTTTTAGGATAAAGAAAAAGCTCA 389 Query 11 Sbjct 31 ESLEAIRHRIAQIVQSLTHFLAILHQSESLSPWPTIHKNFNILLSQIHSLSNNLAAHSHT ESLEAIRHRIAQIVQSLTHFLAILHQSESLSPWPTIHKNFNILLSQIHSLSNNLAAHSHT ++L+A+R R+AQ+ SL + ++E L W T+ N+ LSQ+ S+++ L T QALDAVRMRLAQLTHSLRRIRDEMSKAEQALDAVRMRLAQLTHSLRRIRDEMSKAE-LPQWYTLQSQLNVTLSQLVSVTSTLQHFQET Genom szekvenálás 70 89 2000. jú június 2626-án, Clinton amerikai elnö elnök és Blair brit miniszterelnö miniszterelnök kö közös sajtóé rtekezleten jelentetté sajtóértekezleten jelentették be, hogy az ember öröklé klési

anyagá anyagának teljes informá információ ciótartalmá tartalmát lé lényegé nyegében megfejtetté é k, az a há á rommilliá megfejtett h rommilliárd dollá dolláros tervezett kö költsé ltségveté gvetésű kutatá 1990-ben ezt a kutatási program, amely 1990célt tű tűzte ki: sikerrel já járt. 4 1. Random kló klónok 2.A kló klónok szekvená szekvenálása 3. Átfedő tfedő szekvenciá szekvenciák keresé keresése Ellenő Ellenőrzé rzés Teljes szekvencia Kromoszóma A DNS mennyisé mennyisége nincs korrelá korreláció cióban a faj komplexitá komplexitásával Kromoszóma és gén 5 Gének száma egyes genomokban 2% A Single Nucleotide Polymorphism polimorfizmus), másné snéven SNP 30 000 (egyszerű (egyszerű nukleotid Egy DNS szekvencia variá variáció ció, mely akkor jö jön lé létre, ha egy nukleotid a genomban megvá megváltozik. Példá ldául: AAGCCTA AAGCT AAGCTTA Csak akkor tekinthetjü tekinthetjük a variá

variáció ciót SNPSNP-nek, nek, ha a populá populáció ció legalá legalább 1%1%-ában megjelenik. A SNPSNP-k teszik ki a humá humán genetikai variá variáció ciók 90%90%-át, és minden 100humán genomban. genomban. 100-300 bázispá zispáronké ronként megjelenik a humá Minden 3 SNPb ő l 2 ben a citozint timin cseré é li le. SNP cser Az emberi DNSDNS-ben lejá lejátszó tszódó változá ltozások hatá hatással vannak arra, hogy hogyan reagá reagál az emberi szervezet a betegsé betegségekre, gekre, bakté rusokra, kemiká kemikáliá liákra. kra. baktériumokra, riumokra, vírusokra, Az SNPSNP-k nagy segí segítsé tséget jelentenek az orvosi kutatá kutatásokban, sokban, gyó kifejlesztésében, mivel ezek nem sokat vá változnak gyógyszerek kifejleszté generá generáció cióról generá generáció cióra, azaz a populá populáció ciókban való való SNP kö követé vetés lineá lineáris kö következteté vetkeztetéseket tesz lehető

lehetővé. Az SNPSNP-k pontmutá pontmutáció cióknak tekinthető tekinthetők, melyek voltak olyan sikeresek az evolú végül fontos ré részé szévé váltak a evolúció cióban, ban, hogy vé populá populáció cióknak. 1. Egyes kó kórokozó rokozó bakté baktériumok DNSDNS-nukleotid sorrendjé megfejté lehető teszi e sorrendjének megfejtése lehetővé bakté baktériumok elleni új vakciná vakcinák és antibiotikumok kifejleszté kifejlesztését (pé (példá ldául az agyhá agyhártyagyulladá rtyagyulladást okozó okozó Neisseiria meningitis ellen). 2. A modellszervezetekben megtalá megtalálható lhatók egyes betegsé betegségokozó gokozó emberi gének hasonmá hasonmásai, ezek támpontul szolgá szolgálhatnak e betegsé betegségek új terá terápiá piáinak kidolgozá Pé az Alzheimerkidolgozásához. Példá ldául Alzheimer-kór gé kialakulá á s á ban szerepet já á tszó egyik ó kialakul j tsz génhez hasonló hasonlót talá találtak

fonalfé fonalféregben, ennek segí segítsé tségével remé új gyó kifejleszté remélik gyógyszer kifejlesztését. SNP Kimutatá Kimutatása Egy bevá bevált mó módszer az SNPSNP-k kimutatá kimutatására az RFLP (restriction fragment length polymorphism, polymorphism, azaz restrikció restrikciós fragment hossz polimorfizmus), másné snéven SNPSNP-RFLP. Ha egy allé é l rendelkezik egy restrikció all restrikciós enzim hasí hasítóhellyel, hellyel, mí míg egy má másik nem, akkor a ké két allé allél enzimatikus emé emészté sztése elté eltérő hosszú hosszúságú fragmenteket fog eredmé eredményezni. Abban az esetben, ha nincs ilyen hasí hasítóhely különbsé nbség, akkor a PCR módszert haszná használjá lják. 4. Az ember tö több mint ezer genetikai betegsé betegsége közül né néhány szá száz eseté esetében volt eddig pontosan ismert a betegsé betegségokozó gokozó gén és annak szerkezete. Ez elő előfelté feltétele

minden lehetsé lehetséges oki terá terápiá piának. A jövőben ez minden ilyen betegsé betegség eseté esetében hamarosan ismert lesz. 3. Egyes emberi hormonok, citokinek haszná használatosak gyó gyógyszerké gyszerként is (pé (példá ldául inzulin, interferon). Az emberi DNS nukleotid sorrend alapjá alapján má már több új, eddig ismeretlen emberi hormonjellegű hormonjellegű anyagot azonosí azonosítottak és állí llítottak elő elő, ezek klinikai vizsgá folyamatban van. vizsgálata 6 5. Az embert sú sújtó jtó legfontosabb betegsé betegségek (pé (példá ldául rák, magas vé vérnyomá rnyomás, érelmeszesedé relmeszesedés, cukorbaj, skizofré skizofrénia, ParkinsonParkinson-kór stb.) a szó szó szoros értelmé rtelmében nem örökletes betegsé betegségek. Mai tudá tudásunk szerint azonban kisebb nagyobb mérté rtékben örökletes té tényező nyezők, egyes gé gének elté eltérő működése is szerepet já játszik e

betegsé betegségek kialakulá kialakulásában (pé (példá ldául a cukorbaj eseté esetében eddig azonosí amelyek 17 kü gént különbö nböző azonosítottak, közremű zreműködhetnek e kó kórké rképben). A terá terápia szempontjá szempontjából e té tényező nyezők tisztá tisztázása sokat jelenthet, első elsősorban azé azért, mert a betegek csoportosí csoportosítható thatók genetikai alapon, és a kü különbö nböző csoportokba tartozó tartozó páciensek mind életmó letmódban, mind gyó má elbá gyógyszerezé gyszerezésben más-más elbánást igé igényelhetnek. 7. A farmakogenomika nevű nevű új tudomá tudomány azt vizsgá vizsgálja, hogy az emberi DNS nukleotidnukleotidsorrendben meglé meglévő egyedi kü különbsé nbségek hogyan befolyá befolyásoljá solják a gyó gyógyszerekre való való érzé rzékenysé kenységet. Az USAUSA-ban évente mintegy 100 000 ember hal meg helytelen gyó gyógyszeralkalmazá

gyszeralkalmazás kö következté vetkeztében. Ez a szá szám nem mű műhiba vagy hanyagsá hanyagság miatt ilyen riasztó riasztóan magas, hanem azé azért, mert minden gyó gyógyszerrel kapcsolatban lé léteznek egyé egyének, akik szá számára a szoká szokásos adagban az adott gyó gyógyszer mé mérgező rgező és má más egyedek, akikre a gyó gyógyszer egyá egyáltalá ltalán nem hat. A farmakogenomika célja az, hogy megvaló megvalósulhasson az egyedre, az egyed genetikai "alkatá szabott "alkatára" gyó gyógyszerrendelé gyszerrendelés. 6. Az ismert emberi gyó gyógyszerek tö többnyire valamilyen emberi fehé fehérjé rjével (a gyó gyógyszer cé célpontja) való való kölcsö lcsönhatá nhatás ré révén hatnak. A jelenleg ismert összes cé célpontok szá száma 44-500. A teljes DNSDNSszekvencia ismereté ismeretében elvileg valamennyi (tö (többszá bbszázezer) emberi fehé fehérje megvizsgá megvizsgálható lható a

gyó számára, mint potenciá potenciális cé célpont. lpont. gyógyszerkutató gyszerkutatók szá 8. A má már megvaló megvalósult, de nyilvá nyilvánvaló nvalóan rohamosan terjedő terjedő alkalmazá alkalmazások kö között kell emlí említeni az örökletes betegsé betegségek DNSDNS-diagnosztiká diagnosztikáját. Itt tulajdonké tulajdonképpen nem is helyes a betegsé betegség diagnosztiká diagnosztikájáról beszé beszélni, hiszen tö többnyire arró arról van szó egészsé szséges emberekrő emberekről lehet szó, hogy egé megá megállapí llapítani azt, hogy lá látens hordozó hordozói-e egy betegsé betegségokozó gokozó génnek, amelynek csalá családtervezé dtervezési szempontbó szempontból van jelentő jelentősége, vagy azt, hogy ké később ki fogfog-e ná náluk alakulni a betegsé betegség, esetleg azt, hogy az átlagosná tlagosnál hajlamosabbakhajlamosabbak-e valamely nem örökletes betegsé betegségre (pé (példá

ldául rá rák). Ez kü különösen akkor lehet fontos, ha életmó letmóddal, megelő megelőző műtéttel lehetsé lehetséges lé lépéseket tenni a betegsé betegség ké későbbi megelő kialakulá kialakulásának megelőzésére. 9. A genetikai betegsé betegségek gyó potenciá gyógyí gyításának potenciálisan legfontosabb eszkö eszköze az úgynevezett génterá nterápia, azaz ép gé gén mű működőképes bevitele a beteg egyé egyén sejtjeibe, szervé szervébe. Noha ez az eljá eljárás szá számos nehé nehézsé zséggel kü küzd és alkalmazá alkalmazása néhány bí bíztató ztató kezdeti eredmé eredménnyel még csak kí kísérleti stá stádiumban van, nyilvá a gé teljes nyilvánvaló nvalóan gének megismeré megismerése az elő előfelté feltétele minden sikeres jö jövőbeli alkalmazá alkalmazásnak. 7 PCR Polimerase Chain Reaction 1 2 A genomika genom lépté ptékû bioló biológiá giát jelent, hogy a gének

funkció funkcióit megé megértsü rtsük http://www.biodavidsonedu/courses/g enomics/chip/chip.html vagyis azt, hogy a vizsgá vizsgálatok kiterjedhetnek aká akár az adott élõlé lõlény (pé (példá ldául az ember) összes gé génjé njének DNSDNS-szintû szintû, illetve expresszió expressziós (mRNS és/vagy fehé fehérje) analí analízisé zisére. A teljes genom DNSDNS-szintû szintû megkö megközelí zelítését szerkezeti, az expresszió expressziós vizsgá vizsgálatokat pedig funkcioná funkcionális genomiká genomikának nevezzü nevezzük. mutá mutáció ciók (példá ldául nukleotidcsere) nukleotidcsere) jelenlé jelenlétét vagy hiá hiányá nyát keressü keressük. Ez a módszer veleszü veleszületett génhibá nhibák, illetve az úgynevezett „single nucleotide polymorphism” polymorphism” (SNP) vizsgá vizsgálatá latára haszná használható lható. génexpresszió nexpressziós profil 3 Adatbá Adatbányá nyászá szás –

bioinformatika A kló klón genetikailag azonos élőlények összessé sszességét jelenti. jelenti. Az identikus (egypeté (egypetés, monozigotikus, monozigotikus, esetleg embrió embriófelezé felezéssel lé létrehozott) ikrek kló klónoknak tekinthető tekinthetők, mivel genetikailag azonos egyedek. Idegen DNS bejuttatá bejuttatása petesejtbe: Egé Egérbe nyú nyúl eredetű eredetű β-globin gént ↓ A kifejlő kifejlődött egerek 1515-20%20%-ban kimutatható kimutatható volt a nyú nyúl eredetű eredetű βglobin fehé fehérje 1.É 1.Érett petesejt 2. A petesejt DNSDNS-ének eltá eltávolí volítása 3. SzederSzeder- csí csíra 4. Az embrió embrió szé szétvá tválasztá lasztás sejtjeire 5. Hó Hólyagcsí lyagcsíra 6. A hó hólyagcsí lyagcsíra embrió embriócsomó csomójának szé szétvá tválasztá lasztása sejtekre 7. Embrioná ssejt-tenyé tenyészet Embrionális őssejtindí indítása a hó hólyagcsí lyagcsíra embrió embrió- csomó

csomójának sejtjeibő sejtjeiből 8. Embrioná Embrionális őssejtek 9. Sejttenyé Sejttenyészet indí indítása testi sejtekbő sejtekből 10. Sejttenyé Sejttenyészetszet-eredetű eredetű testi sejtek 11. Sejtmagltetés Sejtmag-átülteté 12. A kló klónkonstrukció nkonstrukció membrá membránjá njának elektrofú elektrofúzió ziója 13. Mestersé Mesterséges zigó zigóta 14. Kló Klónozá nozással elő előállí llított hó hólyagcsí lyagcsíra 15. Embrió Embrióbeü beülteté ltetés A sejtmagsejtmag-átülteté ltetéses kló klónozá nozás lehető lehetőségei: gei: Szuperegé Szuperegér: Egé Egér zigó zigótába patká patkány nö növekedé vekedési hormon gé génjé njét ↓ Különbö ö z ő m éretű nb retű egerek Dolly szü születé letése forradalmian új volt a korá korábbi kló klónozá nozásos kísérletekhez képest, mert egy felnő felnőtt állat má már differenciá differenciálódott sejtjé sejtjét haszná

használtá lták. A kló klónozá nozás alapjá alapjául szolgá szolgáló hámsejtek ugyanis egy akkor má már nem élő, haté hatéves, vemhes állat tő tőgyé gyéből vett, lefagyasztott mintá mintából szá származtak. első első sikeres testi sejtes kló klónozá nozás(1997) 4 Dolly és anyja Dolly utá után má más fajok eseté esetében is (szarvasmarha, egé egér, kecske, serté sertés, macska, nyú nyúl, gaur, gaur, banteng, banteng, muflon, öszvé szvér, ló ló, afrikai vadmacska; összefoglaló sszefoglaló cikket lá lásd Dinnyé Dinnyés et al., al., 2002) sikerü sikerült élő utó utódokat nyerni testi sejtekbő sejtekből. 5